PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold01436-augustus-gene-0.27-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB
Protein Properties Length: 280aa    MW: 31830.7 Da    PI: 8.7847
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold01436-augustus-gene-0.27-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding591e-181461148
                                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                                Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                                   +g W++eEde+l+++++++G g+W+++++  g+ R++k+c++rw +yl
  maker-scaffold01436-augustus-gene-0.27-mRNA-1 14 KGLWSPEEDEKLLNYITKHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                                                   678*******************************************97 PP

2Myb_DNA-binding40.65.9e-1367110146
                                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
                                Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                                    rg++ ++E+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
  maker-scaffold01436-augustus-gene-0.27-mRNA-1  67 RGAFCQQEENLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                                                    788889****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.4E-27663IPR009057Homeodomain-like
PROSITE profilePS5129425.407965IPR017930Myb domain
SuperFamilySSF466892.38E-2912108IPR009057Homeodomain-like
SMARTSM007172.2E-131363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001679.63E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2464116IPR009057Homeodomain-like
PROSITE profilePS5129418.88466116IPR017930Myb domain
SMARTSM007172.2E-1066114IPR001005SANT/Myb domain
PfamPF002497.6E-1267111IPR001005SANT/Myb domain
CDDcd001671.28E-772109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNYIT KHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF CQQEENLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPNTHKPLS EVENEKDMLP TTTKSNEKTS IGSNEQNLIE AKNPKPPPMA AERYTLDASS  180
SSKFENSSGR NNSFTTTPAT QEFFLDRFGG SGTSHETSST SCRPSDLVGY FSFQHLNYGP  240
DIRLSVHPNT SLCFNPNSRE ERSHKVQFEM ELGEGWFSGY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-29121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ8017491e-133JQ801749.1 Populus tomentosa putative transcription factor (MYB216) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039057.11e-134PREDICTED: transcription factor MYB86-like
SwissprotQ8LPH66e-87MYB86_ARATH; Transcription factor MYB86
TrEMBLB9N4051e-134B9N405_POPTR; Myb family transcription factor family protein
STRINGPOPTR_0005s00340.11e-134(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-96myb domain protein 61